Python - necesito ayuda para un programa de python

   
Vista:

necesito ayuda para un programa de python

Publicado por bruno (2 intervenciones) el 15/01/2014 16:39:17
hola buenas tardes.
me gustaria que m ayudaras a un programa que he de hacer de paython, si estubieras interesado o tienes tiempo para ayudarme te mandaria un archivo cn l ejercicio o programa que he de realizar muchas gracias!
que vaya bien!
Valora esta pregunta
Me gusta: Está pregunta es útil y esta claraNo me gusta: Está pregunta no esta clara o no es útil
0
Responder

necesito ayuda para un programa de python

Publicado por bruno (2 intervenciones) el 15/01/2014 19:06:20
este es el programa:
Introducció a la Programació
Pràctica del curs
Es demana que realitzeu un programa amb Python que mostri el següent menú:
1. Anàlisi de contaminació de basses
2. Càlculs estadístics: Biaix de codó
3. Sortir
El programa ha de permetre que l’usuari repetidament seleccioni una opció i s’executi
la tasca seleccionada fins que premi l’opció 3 que es finalitzarà el programa.
Descripció de cada opció:
1. Anàlisi de contaminació de basses:
S’ha fet un estudi per analitzar l’estat de les basses de l’entorn. En cada bassa s’ha
mesurat zero, una o més vegades la concentració de matèria orgànica (DQO), la
concentració d’oxigen (O2) i la biomassa bacteriana (DBO).
Es vol conèixer quina bassa té el màxim i el mínim de cadascuna de les tres
mesures (DQO, O2, DBO).
L’usuari entrarà:
 per cada bassa analitzada:
 un identificador de la bassa i
 el paràmetre mesurat i el valor obtingut per tantes mesures com s’hagin
fet.
 Les mesures de cada bassa es finalitzen amb 0
 La seqüència es finalitzarà amb un -1.
En el cas de que s’hagi mesurat un paràmetre més d’una vegada dins la mateixa
bassa, s’agafarà el promig dels valors obtinguts com a mesura d’aquest paràmetre
en aquesta bassa.
Exemple: (vosaltres els escriureu un sota l’altre)
El_Toll DQO 22 O2 40 DBO 37 O2 36 0 Gran O2 37 DBO 42 0 El_raig DQO 23 DQO
19 O2 60 DBO 36 0 -1
En l’exemple anterior el resultat seria:
La bassa amb més DQO és: El_Toll
La bassa amb menys DQO és: El_raig
La bassa amb més DBO és: Gran
La bassa amb menys DBO és: El_raig
La bassa amb més O2 és: El_raig
La bassa amb menys O2 és: Gran
2. Càlculs estadístics: Biaix de codó
Disposem de dos fitxers:
 El primer és un fitxer amb format FASTA que conté un una primera línia amb la
descripció de la codificació seguida per una seqüència de línies que contenen
una seqüència d’ARN. Exemple:
>ENSG00000128573|ENST00000393495
AUGAUGCAGGAAUCUGCGACAGAGACAAUAAGCAACAGUUCAAUGAAUCAAAAUGGAAUG
AGCACUCUAAGCAGCCAAUUAGAUGCUGGCAGCAGAGAUGGAAGAUCAAGUGGUGACACC
AGCUCUGAAGUAAGCACAGUAGAACUGCUGCAUCUGCAACAACAGCAGCAGCAGCAGCAG
CAGCAGCAGCAACAGCAAUUGGCAGCCCAGCAGCUUGUCUUCCAGCAGCAGCUUCUCCAG
AUGCAACAACUCCAGCAGCAGCAGCAUCUGCUCAGCCUUCAGCGUCAGGGACUCAUCUCC
AUUCCACCUGGCCAGGCAGCACUUCCUGUCCAAUCGCUGCCUCAAGCUGGCUUAAGUCCU
GCUGAGAUUCAGCAGUUAUGGAAAGAAGUGACUGGAGUUCACAGUAUGGAAGACAAUGGC
AUUAAACAUGGAGGGCUAGACCUCACUACUAACAAUUCCUCCUCGACUACCUCCUCCAAC
ACUUCCAAAGCAUCACCACCAAUAACUCAUC
 El segon és un fitxer amb format FASTA que conté una seqüència d’aminoàcids
que es correspon a la codificació de la seqüència donada en el primer fitxer.
Exemple:
>ENSG00000128573|ENST00000393495
MMQESATETISNSSMNQNGMSTLSSQLDAGSRDGRSSGDTSSEVSTVELLHLQQQQQQQQ
QQQQQQLAAQQLVFQQQLLQMQQLQQQQHLLSLQRQGLISIPPGQAALPVQSLPQAGLSP
AEIQQLWKEVTGVHSMEDNGIKHGGLDLTTNNSSSTTSSNTSKASPPITH
Es demana que es calculi el biaix de codó: per cada aminoàcid donar el percentatge
d’utilització de cada codó en la codificació i quantes vegades apareix.
Exemple:
A : GCU – 3 - 33,33%
GCC – 1 - 11,11%
GCA – 4 - 44,44%
GCG – 1 - 11,11%
D : GAU – 2 - 40%
GAC – 3 - 60%
Q : CAA – 10 – 27,77%
CAG – 26 – 72,22%
...
Valora esta respuesta
Me gusta: Está respuesta es útil y esta claraNo me gusta: Está respuesta no esta clara o no es útil
0
Comentar