Python - Fichero FASTA en Python

   
Vista:

Fichero FASTA en Python

Publicado por Lourdes (2 intervenciones) el 04/01/2015 14:01:32
Hola! Tengo un fichero FASTA del que quiero sacar unos datos y ponerlos en una base de datos (que he creado con SQL). Quiero hacer un programa con Python que me haga eso pero no se muy bien cómo empezar...
Lo primero sería hacer un programa que parsee FASTA?
Muchas gracias.
Valora esta pregunta
Me gusta: Está pregunta es útil y esta claraNo me gusta: Está pregunta no esta clara o no es útil
0
Responder
Imágen de perfil de xve

Fichero FASTA en Python

Publicado por xve (1229 intervenciones) el 05/01/2015 09:18:12
Hola Lourdes, no se que es FASTA... que tipo de archivo es? nos puedes adjuntar uno para verlo?
Valora esta respuesta
Me gusta: Está respuesta es útil y esta claraNo me gusta: Está respuesta no esta clara o no es útil
0
Comentar

Fichero FASTA en Python

Publicado por Lourdes (2 intervenciones) el 05/01/2015 09:25:48
Hola, muchas gracias por la respuesta. Fasta es un formato de fichero informático basado en texto, se usa en biología para representar secuencias de aminoácidos. Se caracteriza porque la cabecera empieza por ">" y luego tiene información separada por |
Esa información separada por | es la que quiero meter en la tabla que he hecho con SQL.

Te pongo un ejemplo:

>gi|5524211|gb|AAD44166.1| cytochrome b [Elephas maximus maximus]
LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV
EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG
LLILILLLLLLALLSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVIL
GLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYPYTIIGQMASILYFSIILAFLPIAGX
IENY
Valora esta respuesta
Me gusta: Está respuesta es útil y esta claraNo me gusta: Está respuesta no esta clara o no es útil
0
Comentar
Imágen de perfil de xve

Fichero FASTA en Python

Publicado por xve (1229 intervenciones) el 05/01/2015 19:31:21
Hola Lourdes, si por ejemplo:
1
cadena=">gi|5524211|gb|AAD44166.1| cytochrome b [Elephas maximus maximus]"

para obtener las partes de la misma, puedes hacerlo con:
1
valores=cadena[1:].split("|")

De esta menera ya tienes todos los valores para añadirlos a la base de datos... es esto lo que buscabas?
Valora esta respuesta
Me gusta: Está respuesta es útil y esta claraNo me gusta: Está respuesta no esta clara o no es útil
0
Comentar